OR5T2 Peptide - C-terminal region

Product Overview

• Article Name: OR5T2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004171
• Supplier Catalog Number: orb2004171
• Alternative Catalog Number: BYT-ORB2004171-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: OR11-177

Product Description

OR5T2 Peptide - C-terminal region

Product Properties

• NCBI: 001004746
• UniProt: Q8NGG2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PSSSYASDHDMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVI

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OR5T2 Rabbit Polyclonal Antibody (orb587615). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings