OR5L1 Peptide - C-terminal region

Product Overview

• Article Name: OR5L1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004174
• Supplier Catalog Number: orb2004174
• Alternative Catalog Number: BYT-ORB2004174-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: OST262, OR11-151

Product Description

OR5L1 Peptide - C-terminal region

Product Properties

• NCBI: 001004738
• UniProt: Q8NGL2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKEVKEALRQTWSRFHCPG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OR5L1 Rabbit Polyclonal Antibody (orb327056). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings