OR5V1 Peptide - C-terminal region

Product Overview

• Article Name: OR5V1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004175
• Supplier Catalog Number: orb2004175
• Alternative Catalog Number: BYT-ORB2004175-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: 6M1-21, hs6M1-21

Product Description

OR5V1 Peptide - C-terminal region

Product Properties

• NCBI: 110503
• UniProt: Q9UGF6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: RPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OR5V1 Rabbit Polyclonal Antibody (orb587612). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings