OR5AP2 Peptide - C-terminal region

Product Overview

• Article Name: OR5AP2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004178
• Supplier Catalog Number: orb2004178
• Alternative Catalog Number: BYT-ORB2004178-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: OR9J1

Product Description

OR5AP2 Peptide - C-terminal region

Product Properties

• NCBI: 001002925
• UniProt: Q8NGF4
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: MYLRPTSSYSMEQDKVVSVFYTVIIPVLNPLIYSLKNKDVKKALKKILWK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OR5AP2 Rabbit Polyclonal Antibody (orb587607). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings