DENND5A Peptide - N-terminal region

Product Overview

• Article Name: DENND5A Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004181
• Supplier Catalog Number: orb2004181
• Alternative Catalog Number: BYT-ORB2004181-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

DENND5A Peptide - N-terminal region

Product Properties

• UniProt: B4DFB6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: RYPENVEWNPFDQDAVGMLCMPKGLAFKTQADPREPQFHAFIITREDGSR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DENND5A Rabbit Polyclonal Antibody (orb582664). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings