GP1BA Peptide - middle region

Catalog Number: BYT-ORB2004182
Article Name: GP1BA Peptide - middle region
Biozol Catalog Number: BYT-ORB2004182
Supplier Catalog Number: orb2004182
Alternative Catalog Number: BYT-ORB2004182-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
GP1BA Peptide - middle region
UniProt: E0D852
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: TPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with GP1BA Rabbit Polyclonal Antibody (orb581344). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings