CDH19 Peptide - middle region

Catalog Number: BYT-ORB2004187
Article Name: CDH19 Peptide - middle region
Biozol Catalog Number: BYT-ORB2004187
Supplier Catalog Number: orb2004187
Alternative Catalog Number: BYT-ORB2004187-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
CDH19 Peptide - middle region
UniProt: Q9H159
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: LLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with CDH19 Rabbit Polyclonal Antibody (orb580798). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings