Phf7 Peptide - C-terminal region

Product Overview

• Article Name: Phf7 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004195
• Supplier Catalog Number: orb2004195
• Alternative Catalog Number: BYT-ORB2004195-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

Phf7 Peptide - C-terminal region

Product Properties

• UniProt: Q9DAG9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: AIYHRKCIQKYAHTSAKHFFKCPQCNNREEFPQEMLRMGIHIPDRRWRLI

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Phf7 Rabbit Polyclonal Antibody (orb578758). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings