STAU2 Peptide - C-terminal region

Product Overview

• Article Name: STAU2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004202
• Supplier Catalog Number: orb2004202
• Alternative Catalog Number: BYT-ORB2004202-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

STAU2 Peptide - C-terminal region

Product Properties

• UniProt: Q9NUL3
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: AMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with STAU2 Rabbit Polyclonal Antibody (orb577769). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings