NR2E3 Peptide - C-terminal region

Product Overview

• Article Name: NR2E3 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004204
• Supplier Catalog Number: orb2004204
• Alternative Catalog Number: BYT-ORB2004204-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

NR2E3 Peptide - C-terminal region

Product Properties

• UniProt: Q8IVZ9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with NR2E3 Rabbit Polyclonal Antibody (orb576950). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings