Nr2c1 Peptide - middle region

Catalog Number: BYT-ORB2004206
Article Name: Nr2c1 Peptide - middle region
Biozol Catalog Number: BYT-ORB2004206
Supplier Catalog Number: orb2004206
Alternative Catalog Number: BYT-ORB2004206-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Nr2c1 Peptide - middle region
UniProt: Q505F1
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: GSTPGKVFLTTPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDL
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Nr2c1 Rabbit Polyclonal Antibody (orb576458). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings