Lhx8 Peptide - C-terminal region

Product Overview

• Article Name: Lhx8 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004207
• Supplier Catalog Number: orb2004207
• Alternative Catalog Number: BYT-ORB2004207-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

Lhx8 Peptide - C-terminal region

Product Properties

• UniProt: Q3TVH4
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: VSPNHSSSAPVTAVPSSRLSPPMLEEMAYSAYVPQDGTMLTALHSYMDAH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with LHX8 Rabbit Polyclonal Antibody (orb576205). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings