ZNF471 Peptide - C-terminal region

Product Overview

• Article Name: ZNF471 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004211
• Supplier Catalog Number: orb2004211
• Alternative Catalog Number: BYT-ORB2004211-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ERP1, Z1971

Product Description

ZNF471 Peptide - C-terminal region

Product Properties

• NCBI: 065864
• UniProt: Q9BX82
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: KPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQ

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ZNF471 Rabbit Polyclonal Antibody (orb573925). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings