ZNF883 Peptide - C-terminal region

Catalog Number: BYT-ORB2004212
Article Name: ZNF883 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2004212
Supplier Catalog Number: orb2004212
Alternative Catalog Number: BYT-ORB2004212-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
ZNF883 Peptide - C-terminal region
NCBI: 001094808
UniProt: P0CG24
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: YQCNECGKSFSLSSALTKHKRIHTRERPYQCTKCGDVFCHSTSLIRHQKT
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ZNF883 Rabbit Polyclonal Antibody (orb573878). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings