NPY2R Peptide - N-terminal region

Catalog Number: BYT-ORB2004216
Article Name: NPY2R Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2004216
Supplier Catalog Number: orb2004216
Alternative Catalog Number: BYT-ORB2004216-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: NPY2-R
NPY2R Peptide - N-terminal region
NCBI: 000901
UniProt: P49146
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: PIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVV
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with NPY2R Rabbit Polyclonal Antibody (orb573679). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings