SKP2 Peptide - C-terminal region

Product Overview

• Article Name: SKP2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004218
• Supplier Catalog Number: orb2004218
• Alternative Catalog Number: BYT-ORB2004218-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

SKP2 Peptide - C-terminal region

Product Properties

• UniProt: Q13309
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: TLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SKP2 Rabbit Polyclonal Antibody (orb573605). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings