TTC30A Peptide - C-terminal region

Catalog Number: BYT-ORB2004231
Article Name: TTC30A Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2004231
Supplier Catalog Number: orb2004231
Alternative Catalog Number: BYT-ORB2004231-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
TTC30A Peptide - C-terminal region
NCBI: 689488
UniProt: Q86WT1
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: IEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEP
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TTC30A Rabbit Polyclonal Antibody (orb587789). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings