TTC24 Peptide - C-terminal region

Product Overview

• Article Name: TTC24 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004234
• Supplier Catalog Number: orb2004234
• Alternative Catalog Number: BYT-ORB2004234-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

TTC24 Peptide - C-terminal region

Product Properties

• NCBI: 001099139
• UniProt: A2A3L6
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: HRSSSGWEDEEFEEGHQKKKEERSANVPVRAGPGRPELCFLPGTVNHSHH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TTC24 Rabbit Polyclonal Antibody (orb327133). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings