TTC23 Peptide - C-terminal region

Product Overview

• Article Name: TTC23 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004235
• Supplier Catalog Number: orb2004235
• Alternative Catalog Number: BYT-ORB2004235-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: HCC-8

Product Description

TTC23 Peptide - C-terminal region

Product Properties

• NCBI: 075056
• UniProt: Q5W5X9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TTC23 Rabbit Polyclonal Antibody (orb587786). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings