TSPAN11 Peptide - middle region

Catalog Number: BYT-ORB2004236
Article Name: TSPAN11 Peptide - middle region
Biozol Catalog Number: BYT-ORB2004236
Supplier Catalog Number: orb2004236
Alternative Catalog Number: BYT-ORB2004236-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: VSSW1971
TSPAN11 Peptide - middle region
NCBI: 001073978
UniProt: A1L157
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: HLNRTLAENYGQPGATQITASVDRLQQDFKCCGSNSSADWQHSTYILLRE
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TSPAN11 Rabbit Polyclonal Antibody (orb327131). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings