TRIM16L Peptide - N-terminal region

Catalog Number: BYT-ORB2004238
Article Name: TRIM16L Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2004238
Supplier Catalog Number: orb2004238
Alternative Catalog Number: BYT-ORB2004238-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: TRIM70
TRIM16L Peptide - N-terminal region
NCBI: 001032407
UniProt: Q309B1
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TRIM16L Rabbit Polyclonal Antibody (orb587781). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings