TMPRSS7 Peptide - N-terminal region

Catalog Number: BYT-ORB2004243
Article Name: TMPRSS7 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2004243
Supplier Catalog Number: orb2004243
Alternative Catalog Number: BYT-ORB2004243-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
TMPRSS7 Peptide - N-terminal region
NCBI: 001036040
UniProt: Q7RTY8
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: LPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSNNKGG
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TMPRSS7 Rabbit Polyclonal Antibody (orb587778). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings