RGP1 Peptide - middle region

Product Overview

• Article Name: RGP1 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004252
• Supplier Catalog Number: orb2004252
• Alternative Catalog Number: BYT-ORB2004252-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: KIAA0258

Product Description

RGP1 Peptide - middle region

Product Properties

• NCBI: 001073965
• UniProt: Q92546
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: RVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with RGP1 Rabbit Polyclonal Antibody (orb586111). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings