LRWD1 Peptide - middle region

Product Overview

• Article Name: LRWD1 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004259
• Supplier Catalog Number: orb2004259
• Alternative Catalog Number: BYT-ORB2004259-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: LOC304396

Product Description

LRWD1 Peptide - middle region

Product Properties

• NCBI: 001014003
• UniProt: Q66HB0
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: EPLHFLQCHSRNNSPKDLETQLWACAFEPAREEGHSGATSQTVATCGGEA

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with LRWD1 Rabbit Polyclonal Antibody (orb326010). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings