CARD8 Peptide - N-terminal region

Product Overview

• Article Name: CARD8 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004263
• Supplier Catalog Number: orb2004263
• Alternative Catalog Number: BYT-ORB2004263-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

CARD8 Peptide - N-terminal region

Product Properties

• UniProt: Q9Y2G2
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with CARD8 Rabbit Polyclonal Antibody (orb582641). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings