MAGED4 Peptide - middle region

Product Overview

• Article Name: MAGED4 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004276
• Supplier Catalog Number: orb2004276
• Alternative Catalog Number: BYT-ORB2004276-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: MAGE1, MAGEE1, MAGE-E1

Product Description

MAGED4 Peptide - middle region

Product Properties

• NCBI: 001092270
• UniProt: Q96JG8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: YSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGILGTTKDSPKLGLLMVL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MAGED4 Rabbit Polyclonal Antibody (orb55686). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings