ZNF362 Peptide - N-terminal region

Product Overview

• Article Name: ZNF362 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004277
• Supplier Catalog Number: orb2004277
• Alternative Catalog Number: BYT-ORB2004277-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: RN, lin-29

Product Description

ZNF362 Peptide - N-terminal region

Product Properties

• NCBI: 689706
• UniProt: Q5T0B9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: PSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLLVPPAPAESSQA

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ZNF362 Rabbit Polyclonal Antibody (orb581216). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings