MANEAL Peptide - middle region

Product Overview

• Article Name: MANEAL Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004282
• Supplier Catalog Number: orb2004282
• Alternative Catalog Number: BYT-ORB2004282-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: RP11-109P14.3

Product Description

MANEAL Peptide - middle region

Product Properties

• NCBI: 689709
• UniProt: Q5VSG8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: YTYFASNGFSFGSSHQNWKAVKNFCDANNLMFIPSVGPGYIDTSIRPWNN

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MANEAL Rabbit Polyclonal Antibody (orb325516). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings