DHDDS Peptide - C-terminal region

Catalog Number: BYT-ORB2004284
Article Name: DHDDS Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2004284
Supplier Catalog Number: orb2004284
Alternative Catalog Number: BYT-ORB2004284-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
DHDDS Peptide - C-terminal region
UniProt: Q86SQ9
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: ARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARR
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DHDDS Rabbit Polyclonal Antibody (orb325429). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings