SGCB Peptide - middle region

Catalog Number: BYT-ORB2004300
Article Name: SGCB Peptide - middle region
Biozol Catalog Number: BYT-ORB2004300
Supplier Catalog Number: orb2004300
Alternative Catalog Number: BYT-ORB2004300-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
SGCB Peptide - middle region
UniProt: Q6IBJ4
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SGCB Rabbit Polyclonal Antibody (orb579103). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings