SLC1A6 Peptide - C-terminal region

Product Overview

• Article Name: SLC1A6 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004302
• Supplier Catalog Number: orb2004302
• Alternative Catalog Number: BYT-ORB2004302-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: EAAT4

Product Description

SLC1A6 Peptide - C-terminal region

Product Properties

• NCBI: 005062
• UniProt: Q8N753
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: QFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGT

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SLC1A6 Rabbit Polyclonal Antibody (orb578979). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings