HERC3 Peptide - middle region

Product Overview

• Article Name: HERC3 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004308
• Supplier Catalog Number: orb2004308
• Alternative Catalog Number: BYT-ORB2004308-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

HERC3 Peptide - middle region

Product Properties

• UniProt: F5GWU0
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LHFPLALYKKLLNVKPGLEDLKELSPTEGRSLQELLDYPGEDVEETFCLN

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with HERC3 Rabbit Polyclonal Antibody (orb578764). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings