FHR4 Peptide - N-terminal region

Product Overview

• Article Name: FHR4 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004322
• Supplier Catalog Number: orb2004322
• Alternative Catalog Number: BYT-ORB2004322-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CFHL4, FHR-4, FHR4

Product Description

FHR4 Peptide - N-terminal region

Product Properties

• NCBI: 006675
• UniProt: Q5DVJ7
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LWVSCANGQEVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with FHR4 Rabbit Polyclonal Antibody (orb324954). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings