Asl Peptide - C-terminal region

Catalog Number: BYT-ORB2007921
Article Name: Asl Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2007921
Supplier Catalog Number: orb2007921
Alternative Catalog Number: BYT-ORB2007921-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: 2510006M18Rik
Asl Peptide - C-terminal region
Molecular Weight: 52kDa
NCBI: 598529
UniProt: Q91YI0
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: MPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVF
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Asl Rabbit Polyclonal Antibody (orb584945). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings