Hsp90aa1 Peptide - C-terminal region

Product Overview

• Article Name: Hsp90aa1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2007922
• Supplier Catalog Number: orb2007922
• Alternative Catalog Number: BYT-ORB2007922-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: 86kDa, 89kDa, AL024080, AL024147, Hsp86-1, Hsp89, Hsp90, Hspca, hsp4

Product Description

Hsp90aa1 Peptide - C-terminal region

Product Properties

• Molecular Weight: 85kDa
• NCBI: 034610
• UniProt: P07901
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: ILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRK

Application Notes

• Application Notes: This is a synthetic peptide designed for use in combination with Hsp90aa1 Rabbit Polyclonal Antibody (orb584943). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.