GUCY1B1 Peptide - N-terminal region

Product Overview

• Article Name: GUCY1B1 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2007924
• Supplier Catalog Number: orb2007924
• Alternative Catalog Number: BYT-ORB2007924-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: GCbeta1, Gucy1b3, GC-S-beta-1

Product Description

GUCY1B1 Peptide - N-terminal region

Product Properties

• Molecular Weight: 70kDa
• NCBI: 059497
• UniProt: O54865
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: IGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLD

Application Notes

• Application Notes: This is a synthetic peptide designed for use in combination with GUCY1B1 Rabbit Polyclonal Antibody (orb584926). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.