Rab5a Peptide - middle region

Catalog Number: BYT-ORB2007925
Article Name: Rab5a Peptide - middle region
Biozol Catalog Number: BYT-ORB2007925
Supplier Catalog Number: orb2007925
Alternative Catalog Number: BYT-ORB2007925-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: 2410015H04Rik, AI663973, AU021172
Rab5a Peptide - middle region
Molecular Weight: 24kDa
NCBI: 080163
UniProt: Q9CQD1
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: GAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKR
Application Notes: This is a synthetic peptide designed for use in combination with Rab5a Rabbit Polyclonal Antibody (orb584925). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.