Stx7 Peptide - N-terminal region

Catalog Number: BYT-ORB2007927
Article Name: Stx7 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2007927
Supplier Catalog Number: orb2007927
Alternative Catalog Number: BYT-ORB2007927-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: AI315064, AI317144, AW107239, Syn7
Stx7 Peptide - N-terminal region
Molecular Weight: 30kDa
NCBI: 058077
UniProt: Q9JMJ6
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: ITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFG
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Stx7 Rabbit Polyclonal Antibody (orb584898). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings