Hprt Peptide - C-terminal region

Catalog Number: BYT-ORB2007930
Article Name: Hprt Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2007930
Supplier Catalog Number: orb2007930
Alternative Catalog Number: BYT-ORB2007930-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: C81579, HPGRT, Hprt1, MGC103149
Hprt Peptide - C-terminal region
Molecular Weight: 24kDa
NCBI: 038584
UniProt: P00492
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: SRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Hprt Rabbit Polyclonal Antibody (orb584881). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings