IL1R1 Peptide - C-terminal region

Product Overview

• Article Name: IL1R1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2007951
• Supplier Catalog Number: orb2007951
• Alternative Catalog Number: BYT-ORB2007951-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CD121A, D2S1473, IL-1R-alpha, IL1R, IL1RA, P80

Product Description

IL1R1 Peptide - C-terminal region

Product Properties

• Molecular Weight: 63kDa
• NCBI: 000868
• UniProt: P14778
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: LELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYH

Application Notes

• Application Notes: This is a synthetic peptide designed for use in combination with IL1R1 Rabbit Polyclonal Antibody (orb333740). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.