TUBB3 Peptide - C-terminal region

Product Overview

• Article Name: TUBB3 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2007953
• Supplier Catalog Number: orb2007953
• Alternative Catalog Number: BYT-ORB2007953-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CFEOM3A, MC1R, TUBB4, beta-4, CDCBM

Product Description

TUBB3 Peptide - C-terminal region

Product Properties

• Molecular Weight: 50kDa
• NCBI: 006077
• UniProt: Q13509
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: EGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TUBB3 Rabbit Polyclonal Antibody (orb585767). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings