TFRC Peptide - N-terminal region

Product Overview

• Article Name: TFRC Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2007955
• Supplier Catalog Number: orb2007955
• Alternative Catalog Number: BYT-ORB2007955-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CD71, TFR, TFR1, TRFR, T9, TR, p90

Product Description

TFRC Peptide - N-terminal region

Product Properties

• Molecular Weight: 84kDa
• NCBI: 003225
• UniProt: P02786
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: PVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPRE

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TFRC Rabbit Polyclonal Antibody (orb333739). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings