TNFAIP6 Peptide - C-terminal region

Catalog Number: BYT-ORB2007957
Article Name: TNFAIP6 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2007957
Supplier Catalog Number: orb2007957
Alternative Catalog Number: BYT-ORB2007957-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: TSG-6, TSG6
TNFAIP6 Peptide - C-terminal region
Molecular Weight: 30kDa
NCBI: 009046
UniProt: P98066
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: DIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGN
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TNFAIP6 Rabbit Polyclonal Antibody (orb585732). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings