TNFRSF13B Peptide - N-terminal region

Product Overview

• Article Name: TNFRSF13B Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2007958
• Supplier Catalog Number: orb2007958
• Alternative Catalog Number: BYT-ORB2007958-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CD267, CVID, FLJ39942, MGC133214, MGC39952, TACI, TNFRSF14B, CVID2

Product Description

TNFRSF13B Peptide - N-terminal region

Product Properties

• Molecular Weight: 32kDa
• NCBI: 036584
• UniProt: O14836
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: LLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASI

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with TNFRSF13B Rabbit Polyclonal Antibody (orb585728). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings