NRTN Peptide - C-terminal region

Catalog Number: BYT-ORB2007959
Article Name: NRTN Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2007959
Supplier Catalog Number: orb2007959
Alternative Catalog Number: BYT-ORB2007959-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: NTN
NRTN Peptide - C-terminal region
Molecular Weight: 22kDa
NCBI: 004549
UniProt: Q99748
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: YDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with NRTN Rabbit Polyclonal Antibody (orb585723). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings