LAT2 Peptide - C-terminal region

Product Overview

• Article Name: LAT2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2007960
• Supplier Catalog Number: orb2007960
• Alternative Catalog Number: BYT-ORB2007960-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: HSPC046, LAB, NTAL, WBSCR15, WBSCR5, WSCR5

Product Description

LAT2 Peptide - C-terminal region

Product Properties

• Molecular Weight: 26kDa
• NCBI: 054865
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: KTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMGQLQREASPGP

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with LAT2 Rabbit Polyclonal Antibody (orb585720). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings