PLEKHG2 Peptide - middle region

Catalog Number: BYT-ORB2009504
Article Name: PLEKHG2 Peptide - middle region
Biozol Catalog Number: BYT-ORB2009504
Supplier Catalog Number: orb2009504
Alternative Catalog Number: BYT-ORB2009504-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: CLG, DKFZp667J2325, FLJ00018, FLJ22458, FLJ38638, ARHGEF42
PLEKHG2 Peptide - middle region
Molecular Weight: 144kDa
NCBI: 073746
UniProt: Q9H7P9
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PLEKHG2 Rabbit Polyclonal Antibody (orb584403). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings