Plekhf2 Peptide - N-terminal region

Catalog Number: BYT-ORB2009505
Article Name: Plekhf2 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009505
Supplier Catalog Number: orb2009505
Alternative Catalog Number: BYT-ORB2009505-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: 1110070J07Rik, AA673237, ZFYVE18
Plekhf2 Peptide - N-terminal region
Molecular Weight: 28kDa
NCBI: 780384
UniProt: Q91WB4
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: RLANSEANTRRISIVESCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKAR
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Plekhf2 Rabbit Polyclonal Antibody (orb581174). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings