PLEKHA1 Peptide - N-terminal region

Catalog Number: BYT-ORB2009507
Article Name: PLEKHA1 Peptide - N-terminal region
Biozol Catalog Number: BYT-ORB2009507
Supplier Catalog Number: orb2009507
Alternative Catalog Number: BYT-ORB2009507-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: TAPP1
PLEKHA1 Peptide - N-terminal region
Molecular Weight: 45kDa
NCBI: 067635
UniProt: Q9HB21
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: LNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQ
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PLEKHA1 Rabbit Polyclonal Antibody (orb583606). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings