PLAT Peptide - middle region

Catalog Number: BYT-ORB2009508
Article Name: PLAT Peptide - middle region
Biozol Catalog Number: BYT-ORB2009508
Supplier Catalog Number: orb2009508
Alternative Catalog Number: BYT-ORB2009508-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: DKFZp686I03148, T-PA, TPA
PLAT Peptide - middle region
Molecular Weight: 53kDa
NCBI: 127509
UniProt: P00750
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PLAT Rabbit Polyclonal Antibody (orb583669). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings